Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia japonica 17KDA surface antigen (omp)

Product Specifications

Product Name Alternative

Omp; RJP_094417 kDa surface antigen

Abbreviation

Recombinant Rickettsia japonica omp protein

Gene Name

Omp

UniProt

Q52764

Expression Region

20-159aa

Organism

Rickettsia japonica (strain ATCC VR-1363 / YH)

Target Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.5 kDa

References & Citations

"Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR."Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Mono(2-ethyl-5-oxohexyl) Phthalate-d4
TRC-M542522-1MG 1 mg

rac Mono(2-ethyl-5-oxohexyl) Phthalate-d4

Sign In for Pricing
View Details
Mouse Cxcr4 activation kit by CRISPRa
GA200769 1 Kit

Mouse Cxcr4 activation kit by CRISPRa

Sign In for Pricing
View Details
ABL2 (NM_007314) Human Over-expression Lysate
LC402128 20 µg

ABL2 (NM_007314) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-2 (BCL2/782), CF647 conjugate, 0.1mg/mL
BNC470782-100 1x 100 µL

Bcl-2 (BCL2/782), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GGTLC1 activation kit by CRISPRa
GA114178 1 Kit

Human GGTLC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Glutathione Disulfide
TRC-G597970-5G 5 g

Glutathione Disulfide

Sign In for Pricing
View Details