Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baylyi Catechol 1,2-dioxygenase (catA)

Product Specifications

Product Name Alternative

1,2-CTD

Abbreviation

Recombinant Acinetobacter baylyi catA protein

Gene Name

CatA

UniProt

P07773

Expression Region

1-311aa

Organism

Acinetobacter baylyi

Target Sequence

MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Catechol + O2 = cis, cis-muconate.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.3 kDa

References & Citations

"DNA sequence of the Acinetobacter calcoaceticus catechol 1,2-dioxygenase I structural gene catA: evidence for evolutionary divergence of intradiol dioxygenases by acquisition of DNA sequence repetitions."Neidle E.L., Hartnett C., Bonitz S., Ornston L.N.J. Bacteriol. 170:4874-4880 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Complement Component 4b (C4b) ELISA Kit
RD-C4b-Mu-01 96 Tests

Mouse Complement Component 4b (C4b) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Component 4b (C4b) ELISA Kit
RD-C4b-Mu-02 48 Tests

Mouse Complement Component 4b (C4b) ELISA Kit

Sign In for Pricing
View Details
Human HSPC150 (UBE2T) activation kit by CRISPRa
GA109224 1 Kit

Human HSPC150 (UBE2T) activation kit by CRISPRa

Sign In for Pricing
View Details
DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL
BNCB0725-500 1x 500 µL

DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF405S conjugate, 0.1mg/mL
BNC040824-500 1x 500 µL

CD68 (LAMP4/824), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aminoacylase 1 (ACY1) (NM_001198896) Human Over-expression Lysate
LY434169 100 µg

Aminoacylase 1 (ACY1) (NM_001198896) Human Over-expression Lysate

Sign In for Pricing
View Details