Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nectin-2 (NECTIN2), partial

Product Specifications

Product Name Alternative

Herpes virus entry mediator B Short name: Herpesvirus entry mediator B Short name: HveB Nectin cell adhesion molecule 2 Poliovirus receptor-related protein 2 CD_antigen: CD112

Abbreviation

Recombinant Human NECTIN2 protein, partial

Gene Name

NECTIN2

UniProt

Q92692

Expression Region

32-360aa

Organism

Homo sapiens (Human)

Target Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Probable cell adhesion protein.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive

Molecular Weight

39.2 kDa

References & Citations

"A cell surface protein with herpesvirus entry activity (HveB) confers susceptibility to infection by mutants of herpes simplex virus type 1, herpes simplex virus type 2, and pseudorabies virus."Warner M.S., Geraghty R.J., Martinez W.M., Montgomery R.I., Whitbeck J.C., Xu R., Eisenberg R.J., Cohen G.H., Spear P.G.Virology 246:179-189 (1998) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPEPL1 Human Over-expression Lysate
orb1350885 100 µg

NPEPL1 Human Over-expression Lysate

Sign In for Pricing
View Details
CD41a Mouse Monoclonal Antibody
orb248922-01 30 µL

CD41a Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD41a Mouse Monoclonal Antibody
orb248922-02 50 μL

CD41a Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD41a Mouse Monoclonal Antibody
orb248922-03 100 µL

CD41a Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD41a Mouse Monoclonal Antibody
orb248922-04 200 µL

CD41a Mouse Monoclonal Antibody

Sign In for Pricing
View Details
IL17B (Interleukin-17B, IL-17B, Cytokine Zcyto7, Interleukin-20, IL-20, Neuronal Interleukin-17-related Factor, IL20, NIRF, ZCYTO7, UNQ516/PRO1031) (Biotin)
MBS6403667-01 0.1 mL

IL17B (Interleukin-17B, IL-17B, Cytokine Zcyto7, Interleukin-20, IL-20, Neuronal Interleukin-17-related Factor, IL20, NIRF, ZCYTO7, UNQ516/PRO1031) (Biotin)

Sign In for Pricing
View Details