Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Thyroglobulin (Tg), partial

Product Specifications

Product Name Alternative

Tg

Abbreviation

Recombinant Rat Thyroglobulin protein, partial

Gene Name

Tg

UniProt

P06882

Expression Region

21-300aa

Organism

Rattus norvegicus (Rat)

Target Sequence

NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) .

Molecular Weight

48 kDa

References & Citations

"A novel missense mutation (G2320R) in thyroglobulin causes hypothyroidism in rdw rats."Hishinuma A., Furudate S., Oh-Ishi M., Nagakubo N., Namatame T., Ieiri T.Endocrinology 141:4050-4055 (2000) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF-2 (A-1) Alexa Fluor® 680
sc-271847 AF680 200 µg/mL

FGF-2 (A-1) Alexa Fluor® 680

Sign In for Pricing
View Details
SUPER-X PLEX ® Non-Human Primate IGF-I / IGF-II MULTI-PLEX Panel (2-Plex)
PMX470 96 Tests

SUPER-X PLEX ® Non-Human Primate IGF-I / IGF-II MULTI-PLEX Panel (2-Plex)

Sign In for Pricing
View Details
Lentiviral human SLC22A15 shRNA (UAS) - Lentiviral human SLC22A15 shRNA (UAS, RFP) plasmid
GTR15333448 1 Vial

Lentiviral human SLC22A15 shRNA (UAS) - Lentiviral human SLC22A15 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Fibronectin type III domain-containing protein 5 (FNDC5) ELISA Kit
MBS7201843-01 48 Well

Rabbit Fibronectin type III domain-containing protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Fibronectin type III domain-containing protein 5 (FNDC5) ELISA Kit
MBS7201843-02 96 Well

Rabbit Fibronectin type III domain-containing protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Fibronectin type III domain-containing protein 5 (FNDC5) ELISA Kit
MBS7201843-03 5x 96 Well

Rabbit Fibronectin type III domain-containing protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details