Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

Product Specifications

Product Name Alternative

Fc-epsilon RI-alpha Short name: FcERI IgE Fc receptor subunit alpha

Abbreviation

Recombinant Human FCER1A protein, partial

Gene Name

FCER1A

UniProt

P12319

Expression Region

26-205aa

Organism

Homo sapiens (Human)

Target Sequence

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Molecular Weight

23 kDa

References & Citations

"High-level expression of the truncated alpha chain of human high-affinity receptor for IgE as a soluble form by baculovirus-infected insect cells. Biochemical characterization of the recombinant product."Yagi S., Yanagida M., Tanida I., Hasegawa A., Okumura K., Ra C.Eur. J. Biochem. 220:593-598 (1994) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WWC2-AS1 Adenovirus (Human)
50482051 1.0 mL

WWC2-AS1 Adenovirus (Human)

Ask
View Details
Rat Cdkn1b Pre-designed siRNA Set B
SI202458B 1 Each

Rat Cdkn1b Pre-designed siRNA Set B

Ask
View Details
Actin-Related protein 2/3 complex subunit 1B (ARPC1B) Human ELISA Kit
B2355 96 Tests

Actin-Related protein 2/3 complex subunit 1B (ARPC1B) Human ELISA Kit

Ask
View Details
Hexosaminidase A (Hexosaminidase Subunit A, HEXA, Beta-hexosaminidase Subunit alpha, Beta-N-acetylhexosaminidase Subunit alpha, MGC99608, N-acetyl-beta-glucosaminidase Subunit alpha, TSD) (MaxLight 750)
MBS6480281-01 0.1 mL

Hexosaminidase A (Hexosaminidase Subunit A, HEXA, Beta-hexosaminidase Subunit alpha, Beta-N-acetylhexosaminidase Subunit alpha, MGC99608, N-acetyl-beta-glucosaminidase Subunit alpha, TSD) (MaxLight 750)

Ask
View Details
Hexosaminidase A (Hexosaminidase Subunit A, HEXA, Beta-hexosaminidase Subunit alpha, Beta-N-acetylhexosaminidase Subunit alpha, MGC99608, N-acetyl-beta-glucosaminidase Subunit alpha, TSD) (MaxLight 750)
MBS6480281-02 5x 0.1 mL

Hexosaminidase A (Hexosaminidase Subunit A, HEXA, Beta-hexosaminidase Subunit alpha, Beta-N-acetylhexosaminidase Subunit alpha, MGC99608, N-acetyl-beta-glucosaminidase Subunit alpha, TSD) (MaxLight 750)

Ask
View Details
TRIM28, NT (TRIM28, KAP1, RNF96, TIF1B, Transcription intermediary factor 1-beta, E3 SUMO-protein ligase TRIM28, KRAB-associated protein 1, KRAB-interacting protein 1, Nuclear corepressor KAP-1, RING finger protein 96, Tripartite motif-containing protein 28) (AP) discontinued
043225-AP 200 µL

TRIM28, NT (TRIM28, KAP1, RNF96, TIF1B, Transcription intermediary factor 1-beta, E3 SUMO-protein ligase TRIM28, KRAB-associated protein 1, KRAB-interacting protein 1, Nuclear corepressor KAP-1, RING finger protein 96, Tripartite motif-containing protein 28) (AP) discontinued

Ask
View Details