What is the catalog number for Recombinant Human DNA primase small subunit (PRIM1)?

The catalog number for Recombinant Human DNA primase small subunit (PRIM1) is CSB-EP018680HU.

What sizes are available for Recombinant Human DNA primase small subunit (PRIM1)?

Recombinant Human DNA primase small subunit (PRIM1) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human DNA primase small subunit (PRIM1) come in?

Recombinant Human DNA primase small subunit (PRIM1) is available in 3 different pack sizes.

Is Recombinant Human DNA primase small subunit (PRIM1) in stock?

Recombinant Human DNA primase small subunit (PRIM1) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human DNA primase small subunit (PRIM1)?

Recombinant Human DNA primase small subunit (PRIM1) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human DNA primase small subunit (PRIM1)?

Estimated delivery time for Recombinant Human DNA primase small subunit (PRIM1) is approximately 15 business day(s), depending on your location.

Recombinant Human DNA primase small subunit (PRIM1)

Product Specifications

Product Name Alternative

DNA primase 49KDA subunit Short name: p49

Abbreviation

Recombinant Human PRIM1 protein

Gene Name

PRIM1

UniProt

P49642

Expression Region

1-420aa

Organism

Homo sapiens (Human)

Target Sequence

METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.

Molecular Weight

65.9 kDa

References & Citations

"Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features." Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.Mol. Cell. Proteomics 11:M111.015131-M111.015131 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.