Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhi Universal stress protein A (uspA)

Product Specifications

Product Name Alternative

UspA; STY4212; t3925; Universal stress protein A

Abbreviation

Recombinant Salmonella typhi uspA protein

Gene Name

UspA

UniProt

Q8Z268

Expression Region

2-144aa

Organism

Salmonella typhi

Target Sequence

AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Microbiology

Relevance

Required for resistance to DNA-damaging agents.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for resistance to DNA-damaging agents.

Molecular Weight

17.9 kDa

References & Citations

"Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18."Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R.J. Bacteriol. 185:2330-2337 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adra2a Mouse Gene Knockout Kit (CRISPR)
KN500930 1 Kit

Adra2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3491), 0.2mg/mL
BNUB3491-500 1x 500 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3491), 0.2mg/mL

Sign In for Pricing
View Details
MIR1255a Human qPCR Primer Pair (MI0006389)
HP300075 200 Reactions

MIR1255a Human qPCR Primer Pair (MI0006389)

Sign In for Pricing
View Details
ZNF284 antibody
FNab09680 100 µg

ZNF284 antibody

Sign In for Pricing
View Details
CCM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]
TA503461BM 100 µL

CCM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
RYK Antibody
OC-2526-01 50 μL

RYK Antibody

Sign In for Pricing
View Details