Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial

Product Specifications

Product Name Alternative

Blood dendritic cell antigen 2 Short name: BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen: CD303

Abbreviation

Recombinant Human CLEC4C protein, partial

Gene Name

CLEC4C

UniProt

Q8WTT0

Expression Region

45-213aa

Organism

Homo sapiens (Human)

Target Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells

Molecular Weight

22 kDa

References & Citations

"Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells."Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.Eur. J. Immunol. 31:2733-2740 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey IgG (H/L) Antibody (Alk Phos)
GWB-804525 1 mg

Monkey IgG (H/L) Antibody (Alk Phos)

Sign In for Pricing
View Details
Rabbit Monoclonal Thyroid Peroxidase Antibody (TPO/7088R) [PerCP]
NBP3-21049PCP 0.1 mL

Rabbit Monoclonal Thyroid Peroxidase Antibody (TPO/7088R) [PerCP]

Sign In for Pricing
View Details
1110017D15Rik (NM_001253788) Mouse Untagged Clone
MC226270 10 µg

1110017D15Rik (NM_001253788) Mouse Untagged Clone

Sign In for Pricing
View Details
GPSM1 Blocking Peptide
MBS9628560-01 1 mg

GPSM1 Blocking Peptide

Sign In for Pricing
View Details
GPSM1 Blocking Peptide
MBS9628560-02 5x 1 mg

GPSM1 Blocking Peptide

Sign In for Pricing
View Details
Peli3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7610003 1.0 µg DNA

Peli3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details