Recombinant Mycobacterium bovis Alpha-crystallin (hspX)
Product Specifications
Product Name Alternative
16KDA antigen HSP 16.3
Abbreviation
Recombinant Mycobacterium bovis hspX protein
Gene Name
HspX
UniProt
P0A5B8
Expression Region
2-144aa
Organism
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Sequence
ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Tag
N-terminal 6xHis-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Microbiology
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
20.1 kDa
References & Citations
"The complete genome sequence of Mycobacterium bovis."Garnier T., Eiglmeier K., Camus J.-C., Medina N., Mansoor H., Pryor M., Duthoy S., Grondin S., Lacroix C., Monsempe C., Simon S., Harris B., Atkin R., Doggett J., Mayes R., Keating L., Wheeler P.R., Parkhill J. Hewinson R.G.Proc. Natl. Acad. Sci. U.S.A. 100:7877-7882 (2003)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472848-500 1x 500 µL
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040043-100 1x 100 µL
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041621-500 1x 500 µL
Endoglin / CD105 (ENG/1621), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details