Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metallothionein-3 (MT3)

Product Specifications

Product Name Alternative

GIFB Short name: GIF Growth inhibitory factor Metallothionein-III Short name: MT-III

Abbreviation

Recombinant Human MT3 protein

Gene Name

MT3

UniProt

P25713

Expression Region

1-68aa

Organism

Homo sapiens (Human)

Target Sequence

MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.

Molecular Weight

22.9 kDa

References & Citations

"The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein."Uchida Y., Takio K., Titani K., Ihara Y., Tomonaga M.Neuron 7:337-347 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 Antigen (CD63) Antibody
abx421801-01 50 µg

CD63 Antigen (CD63) Antibody

Sign In for Pricing
View Details
CD63 Antigen (CD63) Antibody
abx421801-02 100 µg

CD63 Antigen (CD63) Antibody

Sign In for Pricing
View Details
C17orf87 (SCIMP) Human shRNA Lentiviral Particle (Locus ID 388325)
TL307963V 500 µL Each

C17orf87 (SCIMP) Human shRNA Lentiviral Particle (Locus ID 388325)

Sign In for Pricing
View Details
WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (MaxLight 550)
135370-ML550 100 µL

WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (MaxLight 550)

Sign In for Pricing
View Details
Mouse CTSD (Cathepsin D) ELISA Kit
EM22723 96 Tests

Mouse CTSD (Cathepsin D) ELISA Kit

Sign In for Pricing
View Details
Mouse IQ and AAA domain-containing protein 1, Iqca1 ELISA KIT
ELI-39372m 96 Tests

Mouse IQ and AAA domain-containing protein 1, Iqca1 ELISA KIT

Sign In for Pricing
View Details