Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epididymal-specific lipocalin-5 (Lcn5)

Product Specifications

Product Name Alternative

Epididymal retinoic acid-binding protein Short name: E-RABP Short name: mE-RABP Epididymal secretory protein 10 Short name: MEP 10 Cleaved into the following 2 chains: Epididymal-specific lipocalin-5, major form Epididymal-specific lipocalin-5, minor form

Abbreviation

Recombinant Mouse Lcn5 protein

Gene Name

Lcn5

UniProt

A2AJB7

Expression Region

27-192aa

Organism

Mus musculus (Mouse)

Target Sequence

TEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.

Molecular Weight

22.3 kDa

References & Citations

"Isolation, immunolocalization, and sperm-association of three proteins of 18, 25, and 29 kilodaltons secreted by the mouse epididymis." Rankin T.L., Tsuruta K.J., Holland M.K., Griswold M.D., Orgebin-Crist M.-C.Biol. Reprod. 46:747-766 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt (Ab-326) Antibody
8B0817-AAT 50 µg

Akt (Ab-326) Antibody

Sign In for Pricing
View Details
Myc (K422) polyclonal antibody
orb640766-01 25 µL

Myc (K422) polyclonal antibody

Sign In for Pricing
View Details
Myc (K422) polyclonal antibody
orb640766-02 50 μL

Myc (K422) polyclonal antibody

Sign In for Pricing
View Details
Myc (K422) polyclonal antibody
orb640766-03 100 µL

Myc (K422) polyclonal antibody

Sign In for Pricing
View Details
Myc (K422) polyclonal antibody
orb640766-04 200 µL

Myc (K422) polyclonal antibody

Sign In for Pricing
View Details
Recombinant Nocardia farcinica Prokaryotic ubiquitin-like protein Pup (pup)
MBS1310616-01 0.02 mg (E-Coli)

Recombinant Nocardia farcinica Prokaryotic ubiquitin-like protein Pup (pup)

Sign In for Pricing
View Details