Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Resistin-like beta (RETNLB)

Product Specifications

Product Name Alternative

Colon and small intestine-specific cysteine-rich protein Colon carcinoma-related gene protein Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 RELMbeta

Abbreviation

Recombinant Human RETNLB protein

Gene Name

RETNLB

UniProt

Q9BQ08

Expression Region

24-111aa

Organism

Homo sapiens (Human)

Target Sequence

QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Probable hormone.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable hormone.

Molecular Weight

13.4 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ."The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 2J2 Colorimetric Cell-Based ELISA Kit
MBS9500947-01 1 Kit

Cytochrome P450 2J2 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Cytochrome P450 2J2 Colorimetric Cell-Based ELISA Kit
MBS9500947-02 5x 1 Kit

Cytochrome P450 2J2 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Cse1l AAV siRNA Pooled Vector
16911164 1.0 µg

Cse1l AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ZNF767P Antibody
A58214-50UG 50 µg

ZNF767P Antibody

Sign In for Pricing
View Details
ZNF768 Peptide - N-terminal region (AAP58118)
AAP58118-100UG 100 µg

ZNF768 Peptide - N-terminal region (AAP58118)

Sign In for Pricing
View Details
Chicken Coiled coil domain containing protein 24 (CCDC24) ELISA Kit
GTR10329302 96 Well

Chicken Coiled coil domain containing protein 24 (CCDC24) ELISA Kit

Sign In for Pricing
View Details