Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-type lectin domain family 4 member E (Clec4e), partial

Product Specifications

Product Name Alternative

C-type lectin superfamily member 9 Macrophage-inducible C-type lectin

Abbreviation

Recombinant Mouse Clec4e protein, partial

Gene Name

Clec4e

UniProt

Q9R0Q8

Expression Region

46-214aa

Organism

Mus musculus (Mouse)

Target Sequence

TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B.

Molecular Weight

23.6 kDa

References & Citations

"Mincle is an ITAM-coupled activating receptor that senses damaged cells."Yamasaki S., Ishikawa E., Sakuma M., Hara H., Ogata K., Saito T.Nat. Immunol. 9:1179-1188 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atxn3 (NM_021702) Rat Tagged Lenti ORF Clone
RR202345L4 10 µg

Atxn3 (NM_021702) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MYBL2 (Biotin)
569481-01 50 µg

MYBL2 (Biotin)

Sign In for Pricing
View Details
MYBL2 (Biotin)
569481-02 100 µg

MYBL2 (Biotin)

Sign In for Pricing
View Details
Human Calmodulin 2 AssayLite™ Antibody (FITC Conjugate)
22356-05141 2x 75 µg

Human Calmodulin 2 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Cat Connexin 43 ELISA Kit
MBS106391 Inquire

Cat Connexin 43 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human FANCD2 sgRNA gene knockout kit - Lentiviral human FANCD2 sgRNA gene knockout kit (25)
GTR15375207 1 Vial

Lentiviral human FANCD2 sgRNA gene knockout kit - Lentiviral human FANCD2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details