Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2)

Product Specifications

Product Name Alternative

Hydrophobin II Short name: HFBII

Abbreviation

Recombinant Hypocrea jecorina hfb2 protein

Gene Name

Hfb2

UniProt

P79073

Expression Region

16-86aa

Organism

Hypocrea jecorina (Trichoderma reesei)

Target Sequence

AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Responsible for spore hydrophobicity and protection.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Responsible for spore hydrophobicity and protection.

Molecular Weight

23.2 kDa

References & Citations

"Atomic resolution structure of the HFBII hydrophobin, a self-assembling amphiphile."Hakanpaa J., Paananen A., Askolin S., Nakari-Setaelae T., Parkkinen T., Penttilae M., Linder M.B., Rouvinen J.J. Biol. Chem. 279:534-539 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C20orf112 (NOL4L) activation kit by CRISPRa
GA115388 1 Kit

Human C20orf112 (NOL4L) activation kit by CRISPRa

Sign In for Pricing
View Details
METTL14 Human Gene Knockout Kit (CRISPR)
KN400925 1 Kit

METTL14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CNOT1 Rabbit Polyclonal Antibody
TA374925 100 µL

CNOT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638427 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Recombinant Mouse Collectin-11/COLEC11 Protein (Baculovirus, His Tag)
PKSM040809 100 µg

Recombinant Mouse Collectin-11/COLEC11 Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details
MET (NM_001127500) Human Over-expression Lysate
LC426803 20 µg

MET (NM_001127500) Human Over-expression Lysate

Sign In for Pricing
View Details