Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Single Ig IL-1-related receptor (Sigirr)

Product Specifications

Product Name Alternative

Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name: TIR8

Abbreviation

Recombinant Mouse Sigirr protein

Gene Name

Sigirr

UniProt

Q9JLZ8

Expression Region

1-117aa

Organism

Mus musculus (Mouse)

Target Sequence

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity) .

Molecular Weight

14.7 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ."The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit IgG (H&L) Antibody Fluorescein Conjugated Pre-Adsorbed
TA397953 1 mg

Rabbit IgG (H&L) Antibody Fluorescein Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
Human ANKRD13A activation kit by CRISPRa
GA113919 1 Kit

Human ANKRD13A activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC56 (COA3) Human Gene Knockout Kit (CRISPR)
KN401034 1 Kit

CCDC56 (COA3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,4-Butanediol Terephthalate
TRC-B692670-250MG 250 mg

1,4-Butanediol Terephthalate

Sign In for Pricing
View Details
Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3731), CF740 conjugate, 0.1mg/mL
BNC743731-500 1x 500 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3731), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/3393), CF740 conjugate, 0.1mg/mL
BNC743393-100 1x 100 µL

Drebrin 1 (DBN1) (DBN1/3393), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details