Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galectin-4 (Lgals4)

Product Specifications

Product Name Alternative

Gal-4 Alternative name (s) : Lactose-binding lectin 4

Abbreviation

Recombinant Mouse Lgals4 protein

Gene Name

Lgals4

UniProt

Q8K419

Expression Region

1-326aa

Organism

Mus musculus (Mouse)

Target Sequence

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Tags & Cell Markers

Relevance

Galectin that binds lactose and a related range of sugars.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Galectin that binds lactose and a related range of sugars.

Molecular Weight

38.4 kDa

References & Citations

"Crystal structure of the N-terminal domain of mouse galectin-4."RIKEN structural genomics initiative (RSGI) Submitted (OCT-2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Porcine torovirus Hemagglutinin-esterase (HE)
MBS7016570-01 0.02 mg

Recombinant Porcine torovirus Hemagglutinin-esterase (HE)

Sign In for Pricing
View Details
Recombinant Porcine torovirus Hemagglutinin-esterase (HE)
MBS7016570-02 0.1 mg

Recombinant Porcine torovirus Hemagglutinin-esterase (HE)

Sign In for Pricing
View Details
Recombinant Porcine torovirus Hemagglutinin-esterase (HE)
MBS7016570-03 5x 0.1 mg

Recombinant Porcine torovirus Hemagglutinin-esterase (HE)

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS2540131-01 0.06 mL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS2540131-02 0.12 mL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS2540131-03 0.2 mL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details