Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130 (DEFB130)

Product Specifications

Product Name Alternative

Beta-defensin 30 Short name: DEFB-30 Defensin, beta 130

Abbreviation

Recombinant Human DEFB130 protein

Gene Name

DEFB130

UniProt

Q30KQ2

Expression Region

23-79aa

Organism

Homo sapiens (Human)

Target Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Has antibacterial activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.3 kDa

References & Citations

"Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract."Patil A.A., Cai Y., Sang Y., Blecha F., Zhang G.Physiol. Genomics 23:5-17 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C16orf44 (KLHL36) activation kit by CRISPRa
GA112625 1 Kit

Human C16orf44 (KLHL36) activation kit by CRISPRa

Sign In for Pricing
View Details
YKL-40 / CHI3L1 Recombinant Rabbit monoclonal Antibody
HA751594 100 µL

YKL-40 / CHI3L1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytidine 2':3'-cyclic Monophosphate Monosodium Salt (>85%)
TRC-C998355-25MG 25 mg

Cytidine 2':3'-cyclic Monophosphate Monosodium Salt (>85%)

Sign In for Pricing
View Details
LRSAM1 (NM_001190723) Human Over-expression Lysate
LC434379 20 µg

LRSAM1 (NM_001190723) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053 + L1C1), CF647 conjugate, 0.1mg/mL
BNC470755-500 1x 500 µL

Human Kappa Light Chain (HP6053 + L1C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Human IgG4 Antibody
KC-662-01 50 μL

Anti-Human IgG4 Antibody

Sign In for Pricing
View Details