Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Vasopressin V2 receptor (AVPR2), partial

Product Specifications

Product Name Alternative

V2R Alternative name (s) : AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor

Abbreviation

Recombinant Pig AVPR2 protein, partial

Gene Name

AVPR2

UniProt

P32307

Expression Region

292-370aa

Organism

Sus scrofa (Pig)

Target Sequence

WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786) . Involved in renal water reabsorption (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase

Molecular Weight

24.7 kDa

References & Citations

"Molecular cloning and functional characterization of V2 [8-lysine] vasopressin and oxytocin receptors from a pig kidney cell line." Gorbulev V., Buechner H., Akhundova A., Fahrenholz F.Eur. J. Biochem. 215:1-7 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PanK4 (Thr63) Antibody
p188-63t 25 µL

Anti-PanK4 (Thr63) Antibody

Sign In for Pricing
View Details
EML1 Rabbit Polyclonal Antibody (HRP)
orb2110307 100 µL

EML1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
2-Fluoro-4- (1-methylhydrazin-1-yl) benzonitrile
417726-01 100 mg

2-Fluoro-4- (1-methylhydrazin-1-yl) benzonitrile

Sign In for Pricing
View Details
2-Fluoro-4- (1-methylhydrazin-1-yl) benzonitrile
417726-02 250 mg

2-Fluoro-4- (1-methylhydrazin-1-yl) benzonitrile

Sign In for Pricing
View Details
100 L Single-Use Mixing Bag
BIOBGMCSC0100S003 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

100 L Single-Use Mixing Bag

Sign In for Pricing
View Details
Human KLK1 ELISA kit
LF-EK50753 1×96T

Human KLK1 ELISA kit

Sign In for Pricing
View Details