Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD1c (CD1C), partial

Product Specifications

Product Name Alternative

BDCA1; CD1; CD1A; CD1c; CD1c antigen; CD1C antigen c polypeptide; CD1c molecule; CD1C_HUMAN; Cortical thymocyte antigen CD1C; Differentiation antigen CD1 alpha 3; R7; T cell surface glycoprotein CD1c; T-cell surface glycoprotein CD1c

Abbreviation

Recombinant Human CD1C protein, partial

Gene Name

CD1C

UniProt

P29017

Expression Region

18-302aa

Organism

Homo sapiens (Human)

Target Sequence

NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.

Molecular Weight

34.2 kDa

References & Citations

"Human CD1b and CD1c isoforms survey different intracellular compartments for the presentation of microbial lipid antigens."Briken V., Jackman R.M., Watts G.F.M., Rogers R.A., Porcelli S.A.J. Exp. Med. 192:281-288 (2000) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

{5H,6H,7H-Cyclopenta[b]pyridin-7-yl}methanamine dihydrochloride
FDD53022-01 50 mg

{5H,6H,7H-Cyclopenta[b]pyridin-7-yl}methanamine dihydrochloride

Sign In for Pricing
View Details
{5H,6H,7H-Cyclopenta[b]pyridin-7-yl}methanamine dihydrochloride
FDD53022-02 0.5 g

{5H,6H,7H-Cyclopenta[b]pyridin-7-yl}methanamine dihydrochloride

Sign In for Pricing
View Details
Anti-Synapsin I (Rabbit, Polyclonal, IgG)
A100184 100 µL

Anti-Synapsin I (Rabbit, Polyclonal, IgG)

Sign In for Pricing
View Details
B7-H3 (4Ig) /B7-H3b hFc Chimera, Human
Z03889-500 500 µg

B7-H3 (4Ig) /B7-H3b hFc Chimera, Human

Sign In for Pricing
View Details
LPA receptor 1 Antibody, mAb, Rabbit
A03845-100 100 µL

LPA receptor 1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
KIN7E Antibody
orb791477 2 mg

KIN7E Antibody

Sign In for Pricing
View Details