Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mediator of DNA damage checkpoint protein 1 (MDC1), partial

Product Specifications

Product Name Alternative

Nuclear factor with BRCT domains 1

Abbreviation

Recombinant Human MDC1 protein, partial

Gene Name

MDC1

UniProt

Q14676

Expression Region

1892-2082aa

Organism

Homo sapiens (Human)

Target Sequence

APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.

Molecular Weight

22.9 kDa

References & Citations

"53BP1 and NFBD1/MDC1-Nbs1 function in parallel interacting pathways activating ataxia-telangiectasia mutated (ATM) in response to DNA damage."Mochan T.A., Venere M., DiTullio R.A. Jr., Halazonetis T.D.Cancer Res. 63:8586-8591 (2003) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS4 Antibody
MBS7003684-01 0.05 mg

ADAMTS4 Antibody

Sign In for Pricing
View Details
ADAMTS4 Antibody
MBS7003684-02 0.1 mg

ADAMTS4 Antibody

Sign In for Pricing
View Details
ADAMTS4 Antibody
MBS7003684-03 5x 0.1 mg

ADAMTS4 Antibody

Sign In for Pricing
View Details
MYOCD sgRNA CRISPR Lentivector (Human) (Target 1)
K1380502 1.0 µg DNA

MYOCD sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SMG1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44448151 3x 1.0 µg DNA

SMG1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Lentiviral mouse Camk2d shRNA (UAS) - Lentiviral mouse Camk2d shRNA (UAS, GFP) (100)
GTR15275433 1 Vial

Lentiviral mouse Camk2d shRNA (UAS) - Lentiviral mouse Camk2d shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details