Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Single Ig IL-1-related receptor (Sigirr), partial

Product Specifications

Product Name Alternative

Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name: TIR8

Abbreviation

Recombinant Mouse Sigirr protein, partial

Gene Name

Sigirr

UniProt

Q9JLZ8

Expression Region

1-117aa

Organism

Mus musculus (Mouse)

Target Sequence

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity) .

Molecular Weight

28.7 kDa

References & Citations

"Intestinal inflammation in mice deficient in Tir8, an inhibitory member of the IL-1 receptor family."Garlanda C., Riva F., Polentarutti N., Buracchi C., Sironi M., De Bortoli M., Muzio M., Bergottini R., Scanziani E., Vecchi A., Hirsch E., Mantovani A.Proc. Natl. Acad. Sci. U.S.A. 101:3522-3526 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Antibody Pair Kit (with Standard)
MBS2102603-01 5x 96 Tests

Human Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Antibody Pair Kit (with Standard)

Ask
View Details
Human Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Antibody Pair Kit (with Standard)
MBS2102603-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Antibody Pair Kit (with Standard)

Ask
View Details
Human Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Antibody Pair Kit (with Standard)
MBS2102603-03 10x 96 Tests

Human Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Antibody Pair Kit (with Standard)

Ask
View Details
Human Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Antibody Pair Kit (with Standard)
MBS2102603-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Antibody Pair Kit (with Standard)

Ask
View Details
ASL siRNA (Mouse)
CRN1058-01 15 nmol

ASL siRNA (Mouse)

Ask
View Details
ASL siRNA (Mouse)
CRN1058-02 30 nmol

ASL siRNA (Mouse)

Ask
View Details