Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2)

Product Specifications

Product Name Alternative

Multisynthase complex auxiliary component p38 Protein JTV-1

Abbreviation

Recombinant Human AIMP2 protein

Gene Name

AIMP2

UniProt

Q13155

Expression Region

1-320aa

Organism

Homo sapiens (Human)

Target Sequence

MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for assembly and stability of the aminoacyl-tRNA synthase complex

Molecular Weight

39.3 kDa

References & Citations

"Initial characterization of the human central proteome."Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Choline Acetyltransferase Antibody
RC-15205-01 50 μL

Recombinant Choline Acetyltransferase Antibody

Sign In for Pricing
View Details
Recombinant Choline Acetyltransferase Antibody
RC-15205-02 100 µL

Recombinant Choline Acetyltransferase Antibody

Sign In for Pricing
View Details
Recombinant Choline Acetyltransferase Antibody
RC-15205-03 1 mL

Recombinant Choline Acetyltransferase Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV Nucleoprotein / NP Protein (His Tag)
PKSV030248 100 µg

Recombinant SARS-CoV Nucleoprotein / NP Protein (His Tag)

Sign In for Pricing
View Details
FAIM3 (FCMR) Rabbit Polyclonal Antibody
TA369117 100 µL

FAIM3 (FCMR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human HENMT1 activation kit by CRISPRa
GA114419 1 Kit

Human HENMT1 activation kit by CRISPRa

Sign In for Pricing
View Details