Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Thy-1 membrane glycoprotein (Thy1)

Product Specifications

Product Name Alternative

Thy-1 antigen CD_antigen: CD90

Abbreviation

Recombinant Mouse Thy1 protein

Gene Name

Thy1

UniProt

P01831

Expression Region

20-131aa

Organism

Mus musculus (Mouse)

Target Sequence

QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Molecular Weight

28.8 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189 (2010) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PRMT6 Mouse mAb
E2200171 100 µL

Anti-PRMT6 Mouse mAb

Sign In for Pricing
View Details
Mouse Monoclonal Myeloid-Associated Differentiation Marker Antibody (MYADM/972) [DyLight 680]
NBP3-11468FR 0.1 mL

Mouse Monoclonal Myeloid-Associated Differentiation Marker Antibody (MYADM/972) [DyLight 680]

Sign In for Pricing
View Details
ZNF454 Rabbit Polyclonal Antibody
orb78117 100 µg

ZNF454 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Leptin (LEP), partial
orb1651728-01 20 µg

Recombinant Human Leptin (LEP), partial

Sign In for Pricing
View Details
Recombinant Human Leptin (LEP), partial
orb1651728-02 100 µg

Recombinant Human Leptin (LEP), partial

Sign In for Pricing
View Details
Recombinant Human Leptin (LEP), partial
orb1651728-03 1 mg

Recombinant Human Leptin (LEP), partial

Sign In for Pricing
View Details