Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Potato leafroll virus Major capsid protein (ORF3)

Product Specifications

Product Name Alternative

Coat protein Short name: CP

Abbreviation

Recombinant Potato leafroll virus ORF3 protein

Gene Name

ORF3

UniProt

P17521

Expression Region

1-208aa

Organism

Potato leafroll virus (strain Potato/Canada/Rowhani/1979) (PLrV)

Target Sequence

MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Major capsid protein.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major capsid protein.

Molecular Weight

27.2 kDa

References & Citations

"Identification and characterization of the potato leafroll virus putative coat protein gene."Kawchuk L.M., Martin R.R., Rochon D.M., McPherson J.J. Gen. Virol. 70:783-788 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD63 Antibody (OTI5E5) [Alexa Fluor 350]
NBP2-70380AF350 0.1 mL

Mouse Monoclonal CD63 Antibody (OTI5E5) [Alexa Fluor 350]

Sign In for Pricing
View Details
Lentiviral human DRAM1 shRNA (UAS) - Lentiviral human DRAM1 shRNA (UAS) plasmid
GTR15335782 1 Vial

Lentiviral human DRAM1 shRNA (UAS) - Lentiviral human DRAM1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Nori® Sheep IL-5 DyLight 488 Polyclonal Antibody
GR203006 50 µg

Nori® Sheep IL-5 DyLight 488 Polyclonal Antibody

Sign In for Pricing
View Details
SNX9 (Sorting Nexin-9, SH3 and PX Domain-containing Protein 1, Protein SDP1, SH3PX1, SH3 and PX Domain-containing Protein 3A, SH3PXD3A) (PE)
MBS6394739-01 0.1 mL

SNX9 (Sorting Nexin-9, SH3 and PX Domain-containing Protein 1, Protein SDP1, SH3PX1, SH3 and PX Domain-containing Protein 3A, SH3PXD3A) (PE)

Sign In for Pricing
View Details
SNX9 (Sorting Nexin-9, SH3 and PX Domain-containing Protein 1, Protein SDP1, SH3PX1, SH3 and PX Domain-containing Protein 3A, SH3PXD3A) (PE)
MBS6394739-02 5x 0.1 mL

SNX9 (Sorting Nexin-9, SH3 and PX Domain-containing Protein 1, Protein SDP1, SH3PX1, SH3 and PX Domain-containing Protein 3A, SH3PXD3A) (PE)

Sign In for Pricing
View Details
MICA Polyclonal Antibody
RD81636A-01 60 μL

MICA Polyclonal Antibody

Sign In for Pricing
View Details