Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial

Product Specifications

Product Name Alternative

Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R

Abbreviation

Recombinant Rat Glp1r protein, partial

Gene Name

Glp1r

UniProt

P32301

Expression Region

22-135aa

Organism

Rattus norvegicus (Rat)

Target Sequence

GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)

Molecular Weight

17.1 kDa

References & Citations

"Molecular cloning of a cDNA encoding for the GLP-1 receptor expressed in rat lung."Lankat-Buttgereit B., Goke R., Fehmann H.C., Richter G., Goke B.Exp. Clin. Endocrinol. 102:341-347 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB18 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV680516 1.0 µg DNA

RAB18 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Canine Heat Shock Protein Beta 3 ELISA Kit
MBS073373-01 48 Well

Canine Heat Shock Protein Beta 3 ELISA Kit

Sign In for Pricing
View Details
Canine Heat Shock Protein Beta 3 ELISA Kit
MBS073373-02 96 Well

Canine Heat Shock Protein Beta 3 ELISA Kit

Sign In for Pricing
View Details
Canine Heat Shock Protein Beta 3 ELISA Kit
MBS073373-03 5x 96 Well

Canine Heat Shock Protein Beta 3 ELISA Kit

Sign In for Pricing
View Details
Canine Heat Shock Protein Beta 3 ELISA Kit
MBS073373-04 10x 96 Well

Canine Heat Shock Protein Beta 3 ELISA Kit

Sign In for Pricing
View Details
Mouse monoclonal mRaspberry/AmCyan1 antibody, clone OTI2A6
TA180029 100 µL

Mouse monoclonal mRaspberry/AmCyan1 antibody, clone OTI2A6

Sign In for Pricing
View Details