Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Platanus acerifolia Putative invertase inhibitor

Product Specifications

Product Name Alternative

Pollen allergen Pla a 1 Allergen: Pla a 1

Abbreviation

Recombinant Platanus acerifolia Putative invertase inhibitor protein

UniProt

Q8GT41

Expression Region

24-179aa

Organism

London plane tree

Target Sequence

ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Allergen

Relevance

Invertase inhibitor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Invertase inhibitor.

Molecular Weight

18.6 kDa

References & Citations

"The major Platanus acerifolia pollen allergen Pla a 1 has sequence homology to invertase inhibitors."Asturias J.A., Ibarrola I., Eraso E., Arilla M.C., Martinez A.Clin. Exp. Allergy 33:978-985 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Rabbit anti-Chicken IgY (H+L) Secondary Antibody [DyLight 405]
NBP1-74781V 0.5 mL

Rabbit Polyclonal Rabbit anti-Chicken IgY (H+L) Secondary Antibody [DyLight 405]

Sign In for Pricing
View Details
Bottles 200 ml PC-FB without screw cap
23 33 71 6 Bottles

Bottles 200 ml PC-FB without screw cap

Sign In for Pricing
View Details
Cholecystokinin A Receptor (Cholecystokinin Receptor Type A, CCK-A Receptor, CCKAR, CCK-AR, CCKRA, Cholecystokinin-1 Receptor, CCK1-R) discontinued
150229 100 µg

Cholecystokinin A Receptor (Cholecystokinin Receptor Type A, CCK-A Receptor, CCKAR, CCK-AR, CCKRA, Cholecystokinin-1 Receptor, CCK1-R) discontinued

Sign In for Pricing
View Details
Fuz (NM_001037646) Rat Tagged Lenti ORF Clone
RR205946L3 10 µg

Fuz (NM_001037646) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum rplC Protein (aa 1-209) (strain 657 / Type Ba4)
VAng-Lsx8509-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Botulinum rplC Protein (aa 1-209) (strain 657 / Type Ba4)

Sign In for Pricing
View Details
BinCARD Polyclonal Antibody
RA22407-01 50 µL

BinCARD Polyclonal Antibody

Sign In for Pricing
View Details