Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma pneumoniae Lon protease (lon), partial

Product Specifications

Product Name Alternative

ATP-dependent protease La

Abbreviation

Recombinant Mycoplasma pneumoniae lon protein, partial

Gene Name

Lon

UniProt

P78025

Expression Region

1-206aa

Organism

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Target Sequence

MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTKRLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSKVPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKII

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner.

Molecular Weight

39.8 kDa

References & Citations

"Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MMP21 Protein Lysate
MBS8415319-01 0.02 mg

Human MMP21 Protein Lysate

Sign In for Pricing
View Details
Human MMP21 Protein Lysate
MBS8415319-02 5x 0.02 mg

Human MMP21 Protein Lysate

Sign In for Pricing
View Details
Biliverdin Reductase A (BLVRA) Antibody (HRP)
abx447873-01 10x 96 Tests

Biliverdin Reductase A (BLVRA) Antibody (HRP)

Sign In for Pricing
View Details
Biliverdin Reductase A (BLVRA) Antibody (HRP)
abx447873-02 5x 96 Tests

Biliverdin Reductase A (BLVRA) Antibody (HRP)

Sign In for Pricing
View Details
Biliverdin Reductase A (BLVRA) Antibody (HRP)
abx447873-03 100 µg

Biliverdin Reductase A (BLVRA) Antibody (HRP)

Sign In for Pricing
View Details
Biliverdin Reductase A (BLVRA) Antibody (HRP)
abx447873-04 96 Tests

Biliverdin Reductase A (BLVRA) Antibody (HRP)

Sign In for Pricing
View Details