Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor XI (F11), partial

Product Specifications

Product Name Alternative

Plasma thromboplastin antecedent Short name:PTA Cleaved into the following 2 chains: Coagulation factor XIa heavy chain Coagulation factor XIa light chain

Abbreviation

Recombinant Human F11 protein, partial

Gene Name

F11

UniProt

P03951

Expression Region

19-387aa

Organism

Homo sapiens (Human)

Target Sequence

ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Molecular Weight

45.2 kDa

References & Citations

"Revisiting the molecular epidemiology of factor XI deficiency: nine new mutations and an original large 4qTer deletion in western Brittany (France) ."Gueguen P., Chauvin A., Quemener-Redon S., Pan-Petesch B., Ferec C., Abgrall J.F., Le Marechal C.Thromb. Haemost. 107:44-50 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Basic Cytokeratin Antibody
V7099IHC-7ML 7 mL

Basic Cytokeratin Antibody

Sign In for Pricing
View Details
PD-L1 (CD274) (B7-H1)
CR311-0.5ml 0.5 mL

PD-L1 (CD274) (B7-H1)

Sign In for Pricing
View Details
DNAJC5B ORF Vector (Human) (pORF)
ORF003206 1.0 µg DNA

DNAJC5B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TMED10, CT (TMED10, TMP21, Transmembrane emp24 domain-containing protein 10, 21kD transmembrane-trafficking protein, S31III125, Tmp-21-I, Transmembrane protein Tmp21, p23, p24 family protein delta-1, p24delta) (Azide free) (HRP)
MBS6356233-01 0.2 mL

TMED10, CT (TMED10, TMP21, Transmembrane emp24 domain-containing protein 10, 21kD transmembrane-trafficking protein, S31III125, Tmp-21-I, Transmembrane protein Tmp21, p23, p24 family protein delta-1, p24delta) (Azide free) (HRP)

Sign In for Pricing
View Details
TMED10, CT (TMED10, TMP21, Transmembrane emp24 domain-containing protein 10, 21kD transmembrane-trafficking protein, S31III125, Tmp-21-I, Transmembrane protein Tmp21, p23, p24 family protein delta-1, p24delta) (Azide free) (HRP)
MBS6356233-02 5x 0.2 mL

TMED10, CT (TMED10, TMP21, Transmembrane emp24 domain-containing protein 10, 21kD transmembrane-trafficking protein, S31III125, Tmp-21-I, Transmembrane protein Tmp21, p23, p24 family protein delta-1, p24delta) (Azide free) (HRP)

Sign In for Pricing
View Details
Human cytokein 17, CK 17 ELISA Kit
MBS7214391-01 48 Well

Human cytokein 17, CK 17 ELISA Kit

Sign In for Pricing
View Details