Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

Product Specifications

Product Name Alternative

Aggretin alpha chain Rhodoaggretin subunit alpha

Abbreviation

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha protein

UniProt

Q9I841

Expression Region

1-136aa

Organism

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Target Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2) . Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2) . Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Molecular Weight

17.8 kDa

References & Citations

"Molecular cloning and sequence analysis of aggretin, a collagen-like platelet aggregation inducer."Chung C.-H., Au L.-C., Huang T.-F.Biochem. Biophys. Res. Commun. 263:723-727 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Paraherquamide E (Antibiotic VM 54159, 14-Deoxy-paraherquamide A)
MBS651504-01 0.5 mg

Paraherquamide E (Antibiotic VM 54159, 14-Deoxy-paraherquamide A)

Ask
View Details
Paraherquamide E (Antibiotic VM 54159, 14-Deoxy-paraherquamide A)
MBS651504-02 5x 0.5 mg

Paraherquamide E (Antibiotic VM 54159, 14-Deoxy-paraherquamide A)

Ask
View Details
Chtf18 Rat shRNA Lentiviral Particle (Locus ID 287146)
TL704370V 500 µL Each

Chtf18 Rat shRNA Lentiviral Particle (Locus ID 287146)

Ask
View Details
PAX6 (NM_001127612) Human Tagged ORF Clone
RG225676 10 µg

PAX6 (NM_001127612) Human Tagged ORF Clone

Ask
View Details
Recombinant Escherichia coli O6 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC), partial
MBS7092642 Inquire

Recombinant Escherichia coli O6 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC), partial

Ask
View Details