Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Myelin basic protein (EGM_08965)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Cynomolgus monkey Myelin basic protein

Gene Name

EGM_08965

UniProt

G7PWA0

Expression Region

1-304aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

MGNHAGKRELNTEKASTNGETNRGESEKKTNLGELSRTTSEDSEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGVPKRGSGKDSHHAARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGVDAQGTLSRIFKLGGRDSRSGSPMARR

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49 kDa

References & Citations

"Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques."Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., van Gool A.J., Du H., Chen J., Chen R., Zhang P., Huang Z., Thompson J.R., Meng Y., Bai Y. Wang J.Nat. Biotechnol. 29:1019-1023 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU7-70P sgRNA CRISPR Lentivector (Human) (Target 1)
K1861502 1.0 µg DNA

RNU7-70P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
3- (4-Iodophenyl) -1H-pyrazole
UQB00792-01 50 mg

3- (4-Iodophenyl) -1H-pyrazole

Sign In for Pricing
View Details
3- (4-Iodophenyl) -1H-pyrazole
UQB00792-02 0.5 g

3- (4-Iodophenyl) -1H-pyrazole

Sign In for Pricing
View Details
1500009L16Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10091154 3x 1.0 µg DNA

1500009L16Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Rat Cross Linked C-Telopeptide Of Type II Collagen (CTX-II) Elisa Kit
EK721066 96 Well

Rat Cross Linked C-Telopeptide Of Type II Collagen (CTX-II) Elisa Kit

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens Enolase (eno)
MBS1474892-01 0.02 mg (E-Coli)

Recombinant Geobacter sulfurreducens Enolase (eno)

Sign In for Pricing
View Details