Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spiroplasma citri Spiralin (spi)

Product Specifications

Product Name Alternative

Spi; Spiralin

Abbreviation

Recombinant Spiroplasma citri spi protein

Gene Name

Spi

UniProt

P19215

Expression Region

24-241aa

Organism

Spiroplasma citri

Target Sequence

CNKTESNNLSIVKTIAVPATVATANPKQVTNAEIKTALEANVLKAVQGVVKTATAADFQFDVYQDNKGTSLTTINLEEGNVEVYVQITPAKDKTVVIGETGYIKVTLPKIKVDISGVVIDQQIVEIKAADPKQVTKDELNAVNTYATLASAVLEAIKNKAPNAGASDFEITNNCDAGDYSAQKDVKVTVKAKDESPNISGEFKVNAKVKATLAPPKAG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Major membrane protein of spiroplasma.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major membrane protein of spiroplasma.

Molecular Weight

39 kDa

References & Citations

"Organization and nucleotide sequences of the Spiroplasma citri genes for ribosomal protein S2, elongation factor Ts, spiralin, phosphofructokinase, pyruvate kinase, and an unidentified protein."Chevalier C., Saillard C., Bove J.M.J. Bacteriol. 172:2693-2703 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL7B (NM_001707) Human Over-expression Lysate
LY419788 100 µg

BCL7B (NM_001707) Human Over-expression Lysate

Sign In for Pricing
View Details
Gasdermin like (GSDMB) (NM_001165958) Human Over-expression Lysate
LC431358 20 µg

Gasdermin like (GSDMB) (NM_001165958) Human Over-expression Lysate

Sign In for Pricing
View Details
Arl4d (NM_025404) Mouse Tagged ORF Clone
MG202064 10 µg

Arl4d (NM_025404) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Pcsk5 activation kit by CRISPRa
GA203128 1 Kit

Mouse Pcsk5 activation kit by CRISPRa

Sign In for Pricing
View Details
JAK3 Recombinant Rabbit Monoclonal Antibody [JM66-31]
ET1705-1 100 µL

JAK3 Recombinant Rabbit Monoclonal Antibody [JM66-31]

Sign In for Pricing
View Details
LRATD1 (NM_145175) Human Recombinant Protein
TP710355 20 µg

LRATD1 (NM_145175) Human Recombinant Protein

Sign In for Pricing
View Details