Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pulmonary surfactant-associated protein C (SFTPC)

Product Specifications

Product Name Alternative

Pulmonary surfactant-associated proteolipid SPL (Val) SP5

Abbreviation

Recombinant Human SFTPC protein

Gene Name

SFTPC

UniProt

P11686

Expression Region

24-58aa

Organism

Homo sapiens (Human)

Target Sequence

FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Molecular Weight

30.7 kDa

References & Citations

"Low molecular weight human pulmonary surfactant protein (SP5) : isolation, characterization, and cDNA and amino acid sequences."Warr R.G., Hawgood S., Buckley D.I., Crisp T.M., Schilling J., Benson B.J., Ballard P.L., Clements J.A., White R.T.Proc. Natl. Acad. Sci. U.S.A. 84:7915-7919 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM131C Pre-designed siRNA Set A
SI005315A 1 Each

Human FAM131C Pre-designed siRNA Set A

Sign In for Pricing
View Details
ATG4A Rabbit Polyclonal Antibody (FITC)
orb2121792 100 µL

ATG4A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
PRICKLE4 ORF Vector (Human) (pORF)
ORF014163 1.0 µg DNA

PRICKLE4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human PKC delta (PRKCD) activation kit by CRISPRa
GA103770 1 Kit

Human PKC delta (PRKCD) activation kit by CRISPRa

Sign In for Pricing
View Details
RPS27 Protein Vector (Rat) (pPB-C-His)
PV302454 500 ng

RPS27 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PAM16 Rabbit pAb
E45R28740N 50 ul

PAM16 Rabbit pAb

Sign In for Pricing
View Details