Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement C1q subcomponent subunit A (C1qa)

Product Specifications

Product Name Alternative

C1qa; Complement C1q subcomponent subunit A

Abbreviation

Recombinant Rat C1qa protein

Gene Name

C1qa

UniProt

P31720

Expression Region

23-245aa

Organism

Rattus norvegicus (Rat)

Target Sequence

EDVCRAPNGKDGVAGIPGRPGRPGLKGERGEPGAAGIRTGIRGLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPPTYGNVVVFDKVLTNQENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSSSRGQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Molecular Weight

39.6 kDa

References & Citations

"Rapid isolation and biochemical characterization of rat C1 and C1q."Wing M.G., Seilly D.J., Bridgman D.J., Harrison R.A.Mol. Immunol. 30:433-440 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B ELISA KIT
E6846Hu-01 48 Well

Human Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B ELISA KIT

Ask
View Details
Human Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B ELISA KIT
E6846Hu-02 96 Well

Human Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B ELISA KIT

Ask
View Details
Human Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B ELISA KIT
E6846Hu-03 5x 96 Tests

Human Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B ELISA KIT

Ask
View Details
Human Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B ELISA KIT
E6846Hu-04 10x 96 Tests

Human Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B ELISA KIT

Ask
View Details
Ccdc173 (NM_001077684) Mouse Tagged Lenti ORF Clone
MR213172L3 10 µg

Ccdc173 (NM_001077684) Mouse Tagged Lenti ORF Clone

Ask
View Details
Human Histone deacetylase 7,HDAC7 ELISA KIT
ELI-19348h 96 Tests

Human Histone deacetylase 7,HDAC7 ELISA KIT

Ask
View Details