Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Oncomodulin (Ocm)

Product Specifications

Product Name Alternative

Parvalbumin beta

Abbreviation

Recombinant Mouse Ocm protein

Gene Name

Ocm

UniProt

P51879

Expression Region

2-109aa

Organism

Mus musculus (Mouse)

Target Sequence

SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.

Molecular Weight

14.1 kDa

References & Citations

"The intracisternal A particle derived solo LTR promoter of the rat oncomodulin gene is not present in the mouse gene."Banville D., Rotaru M., Boie Y.Genetica 86:85-97 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)
MBS1313726-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)
MBS1313726-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)
MBS1313726-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)
MBS1313726-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)
MBS1313726-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)
MBS1313726-06 0.02 mg (Mammalian-Cell)

Recombinant Arabidopsis thaliana Probable WRKY transcription factor 74 (WRKY74)

Sign In for Pricing
View Details