Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein YnaB (ynaB)

Product Specifications

Product Name Alternative

YnaB; BSU17500; Uncharacterized protein YnaB

Abbreviation

Recombinant Bacillus subtilis Uncharacterized protein YnaB protein

Gene Name

YnaB

UniProt

P94480

Expression Region

1-144aa

Organism

Bacillus subtilis (strain 168)

Target Sequence

MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYNEVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDMLVSLNGTKYWEVNPNLQEYYKLVSE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.8 kDa

References & Citations

"The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATXN1L Double Nickase Plasmid (h2)
sc-410432-NIC-2 20 µg

ATXN1L Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Rabbit Polyclonal IRAK1 Antibody [Biotin]
NBP1-77068B 0.1 mL

Rabbit Polyclonal IRAK1 Antibody [Biotin]

Sign In for Pricing
View Details
Rabbit Monoclonal Azurocidin/CAP37/HBP Antibody (308) [DyLight 550]
NBP2-89593R 0.1 mL

Rabbit Monoclonal Azurocidin/CAP37/HBP Antibody (308) [DyLight 550]

Sign In for Pricing
View Details
CD 2314
B5483-10 10 mg

CD 2314

Sign In for Pricing
View Details
Nα-Fmoc-Nε- (Boc-2-aminobenzoyl) -L-lysine
sc-472355 100 mg

Nα-Fmoc-Nε- (Boc-2-aminobenzoyl) -L-lysine

Sign In for Pricing
View Details
TEK Recombinant Protein
OPCD07444-10UG 10 µg

TEK Recombinant Protein

Sign In for Pricing
View Details