Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein YnaB (ynaB)

Product Specifications

Product Name Alternative

YnaB; BSU17500; Uncharacterized protein YnaB

Abbreviation

Recombinant Bacillus subtilis Uncharacterized protein YnaB protein

Gene Name

YnaB

UniProt

P94480

Expression Region

1-144aa

Organism

Bacillus subtilis (strain 168)

Target Sequence

MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYNEVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDMLVSLNGTKYWEVNPNLQEYYKLVSE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.8 kDa

References & Citations

"The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SeroDetect Anti-HCV Verification Panel (5 X 1.5 mL)
KZMC010 5x 1.5 mL

SeroDetect Anti-HCV Verification Panel (5 X 1.5 mL)

Sign In for Pricing
View Details
USP22 Rabbit Polyclonal Antibody (APC-Cy7)
orb2382036 100 µL

USP22 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Cytochrome P450 2B6 (CYP2B6) Antibody
abx330920 100 µL

Cytochrome P450 2B6 (CYP2B6) Antibody

Sign In for Pricing
View Details
Rpl11 3'UTR Lenti-reporter-Luc Vector
40754084 1.0 µg

Rpl11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Human CD218a/IL18R1 Protein, C-Fc
AP93867 50 µg

Recombinant Human CD218a/IL18R1 Protein, C-Fc

Sign In for Pricing
View Details
RNF2 (RING Finger Protein 2, BAP-1, BAP1, DING, HIPI3, Ring1B, Ring2) (MaxLight 550)
MBS6219010-01 0.1 mL

RNF2 (RING Finger Protein 2, BAP-1, BAP1, DING, HIPI3, Ring1B, Ring2) (MaxLight 550)

Sign In for Pricing
View Details