Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Adapter protein MecA (mecA)

Product Specifications

Product Name Alternative

MecA; MW0880Adapter protein MecA

Abbreviation

Recombinant Staphylococcus aureus mecA protein

Gene Name

MecA

UniProt

P60186

Expression Region

1-239aa

Organism

Staphylococcus aureus (strain MW2)

Target Sequence

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis.

Molecular Weight

44.3 kDa

References & Citations

"Genome and virulence determinants of high virulence community-acquired MRSA."Baba T., Takeuchi F., Kuroda M., Yuzawa H., Aoki K., Oguchi A., Nagai Y., Iwama N., Asano K., Naimi T., Kuroda H., Cui L., Yamamoto K., Hiramatsu K.Lancet 359:1819-1827 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-LC3A Antibody (pS12)
F48800-0.08ML 0.08 mL

Phospho-LC3A Antibody (pS12)

Sign In for Pricing
View Details
GLI2 Protein Lysate (Mouse) with C-HA Tag
21599034 100 µg

GLI2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
RNF125 Rabbit Polyclonal Antibody (Biotin)
orb2121004 100 µL

RNF125 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human PRR20B shRNA Plasmid
abx968708-01 150 µg

Human PRR20B shRNA Plasmid

Sign In for Pricing
View Details
Human PRR20B shRNA Plasmid
abx968708-02 300 µg

Human PRR20B shRNA Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal VSTM1 Antibody (01) [Alexa Fluor 647]
NBP3-06135AF647 0.1 mL

Mouse Monoclonal VSTM1 Antibody (01) [Alexa Fluor 647]

Sign In for Pricing
View Details