Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Foldase protein PrsA (prsA)

Product Specifications

Product Name Alternative

PrsA; SACOL1897; Foldase protein PrsA; EC 5.2.1.8

Abbreviation

Recombinant Staphylococcus aureus prsA protein

Gene Name

PrsA

UniProt

Q5HET4

Expression Region

21-320aa

Organism

Staphylococcus aureus (strain COL)

Target Sequence

CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Plays a major role in protein secretion by helping the post-translocational Extracellular domain folding of several secreted proteins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a major role in protein secretion by helping the post-translocational extracellular folding of several secreted proteins.

Molecular Weight

49.6 kDa

References & Citations

"Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain."Gill S.R., Fouts D.E., Archer G.L., Mongodin E.F., DeBoy R.T., Ravel J., Paulsen I.T., Kolonay J.F., Brinkac L.M., Beanan M.J., Dodson R.J., Daugherty S.C., Madupu R., Angiuoli S.V., Durkin A.S., Haft D.H., Vamathevan J.J., Khouri H. Fraser C.M.J. Bacteriol. 187:2426-2438 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp11a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6299906 1.0 µg DNA

Atp11a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Sst sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6789007 1.0 µg DNA

Sst sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
NRP2 Antibody
MBS7129362-01 0.05 mL

NRP2 Antibody

Sign In for Pricing
View Details
NRP2 Antibody
MBS7129362-02 0.1 mL

NRP2 Antibody

Sign In for Pricing
View Details
NRP2 Antibody
MBS7129362-03 5x 0.1 mL

NRP2 Antibody

Sign In for Pricing
View Details
NUP37 Protein Vector (Human) (pPM-C-HA)
32329021 500 ng

NUP37 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details