Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Glc operon transcriptional activator (glcC)

Product Specifications

Product Name Alternative

GlcC; c3710; Glc operon transcriptional activator; Glc regulatory protein; HTH-type transcriptional regulator GlcC

Abbreviation

Recombinant E.coli O6:H1 glcC protein

Gene Name

GlcC

UniProt

P0ACL6

Expression Region

1-254aa

Organism

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Target Sequence

MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGHHLIRSAVPLEMNLS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Activator for the glycolate oxidation locus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Activator for the glycolate oxidation locus.

Molecular Weight

44.8 kDa

References & Citations

"Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli."Welch R.A., Burland V., Plunkett G. III, Redford P., Roesch P., Rasko D., Buckles E.L., Liou S.-R., Boutin A., Hackett J., Stroud D., Mayhew G.F., Rose D.J., Zhou S., Schwartz D.C., Perna N.T., Mobley H.L.T., Donnenberg M.S., Blattner F.R.Proc. Natl. Acad. Sci. U.S.A. 99:17020-17024 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin-converting enzyme (ACE) Antibody (Biotin)
abx341174-01 50 µL

Angiotensin-converting enzyme (ACE) Antibody (Biotin)

Sign In for Pricing
View Details
Angiotensin-converting enzyme (ACE) Antibody (Biotin)
abx341174-02 100 µL

Angiotensin-converting enzyme (ACE) Antibody (Biotin)

Sign In for Pricing
View Details
Angiotensin-converting enzyme (ACE) Antibody (Biotin)
abx341174-03 200 µL

Angiotensin-converting enzyme (ACE) Antibody (Biotin)

Sign In for Pricing
View Details
Angiotensin-converting enzyme (ACE) Antibody (Biotin)
abx341174-04 1 mL

Angiotensin-converting enzyme (ACE) Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Human RABGEF1 Protein, N-His
YHK57901 100 μg

Recombinant Human RABGEF1 Protein, N-His

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) FIS Polyclonal Antibody
MBS7174980 Inquire

Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) FIS Polyclonal Antibody

Sign In for Pricing
View Details