Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans Nitrous-oxide reductase (nosZ)

Product Specifications

Product Name Alternative

N (2) OR N2O reductase

Abbreviation

Recombinant Paracoccus denitrificans nosZ protein

Gene Name

NosZ

UniProt

Q51705

Expression Region

58-553aa

Organism

Paracoccus denitrificans

Target Sequence

ASGDGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTATVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Nitrous-oxide reductase is part of a bacterial respiratory system which is activated under anaerobic conditions in the presence of nitrate or nitrous oxide.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Nitrous-oxide reductase is part of a bacterial respiratory system which is activated under anaerobic conditions in the presence of nitrate or nitrous oxide.

Molecular Weight

71.1 kDa

References & Citations

"Sequence and expression of the gene encoding the respiratory nitrous-oxide reductase from Paracoccus denitrificans. New and conserved structural and regulatory motifs."Hoeren F.U., Berks B.C., Ferguson S.J., McCarthy J.E.G.Eur. J. Biochem. 218:49-57 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gps1 ORF Vector (Mouse) (pORF)
ORF046601 1.0 µg DNA

Gps1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Monkey Integrin beta4 ELISA Kit
MBS027422-01 48 Well

Monkey Integrin beta4 ELISA Kit

Sign In for Pricing
View Details
Monkey Integrin beta4 ELISA Kit
MBS027422-02 96 Well

Monkey Integrin beta4 ELISA Kit

Sign In for Pricing
View Details
Monkey Integrin beta4 ELISA Kit
MBS027422-03 5x 96 Well

Monkey Integrin beta4 ELISA Kit

Sign In for Pricing
View Details
Monkey Integrin beta4 ELISA Kit
MBS027422-04 10x 96 Well

Monkey Integrin beta4 ELISA Kit

Sign In for Pricing
View Details
CCNJL shRNA Plasmid (m)
sc-142166-SH 20 µg

CCNJL shRNA Plasmid (m)

Sign In for Pricing
View Details