Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X)

Product Specifications

Product Name Alternative

HBx Peptide X pX

Abbreviation

Recombinant Hepatitis B virus genotype D subtype ayw protein X

Gene Name

X

UniProt

Q9QMI3

Expression Region

1-154aa

Organism

Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)

Target Sequence

MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma) . Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC) . Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multifunctional protein that plays a role in silencing host antiviral defenses and promoting viral transcription. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma) . Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding host CFLAR, a key regulator of the death-inducing signaling complex (DISC) . Promotes viral transcription by using the host E3 ubiquitin ligase DDB1 to target the SMC5-SMC6 complex to proteasomal degradation. This host complex would otherwise bind to viral episomal DNA, and prevents its transcription. Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT.

Molecular Weight

32.6 kDa

References & Citations

"Typing hepatitis B virus by homology in nucleotide sequence: comparison of surface antigen subtypes."Okamoto H., Tsuda F., Sakugawa H., Sastrosoewignjo R.I., Imai M., Miyakawa Y., Mayumi M.J. Gen. Virol. 69:2575-2583 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®350 Antibody Labeling Kit, 1x (5-20ug) labeling
#92270 1 Kit

Mix-n-StainTM CF®350 Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Scopine Di(2-thienylglycolate)
TRC-S199965-10MG 10 mg

Scopine Di(2-thienylglycolate)

Sign In for Pricing
View Details
MAGEB2 Human Gene Knockout Kit (CRISPR)
KN205338RB 1 Kit

MAGEB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F4]
TA802688BM 100 µL

Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F4]

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS710986 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5), CF488A conjugate, 0.1mg/mL
BNC880890-100 1x 100 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details