Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercurialis annua Profilin

Product Specifications

Product Name Alternative

Pollen allergen Mer a 1 Allergen: Mer a 1

Abbreviation

Recombinant Mercurialis annua Profilin protein

UniProt

O49894

Expression Region

1-133aa

Organism

Annual mercury

Target Sequence

MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Allergen

Relevance

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity) .

Molecular Weight

16.3 kDa

References & Citations

"Characterization of recombinant Mercurialis annua major allergen Mer a 1 (profilin) ."Vallverdu A., Asturias J.A., Arilla M.C., Gomez-Bayon N., Martinez A., Martinez J., Palacios R.J. Allergy Clin. Immunol. 101:363-370 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (PE)
MBS6160588-01 0.1 mL

SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (PE)

Ask
View Details
SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (PE)
MBS6160588-02 5x 0.1 mL

SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (PE)

Ask
View Details
Anti Cat (Feline) Fel d1b Mab
111180 100 µg

Anti Cat (Feline) Fel d1b Mab

Ask
View Details
Lentiviral human SSX1 sgRNA gene knockout kit - Lentiviral human SSX1 sgRNA gene knockout kit (100)
GTR15399244 1 Vial

Lentiviral human SSX1 sgRNA gene knockout kit - Lentiviral human SSX1 sgRNA gene knockout kit (100)

Ask
View Details
TRMT61A siRNA (Human)
CRJ4462-01 15 nmol

TRMT61A siRNA (Human)

Ask
View Details
TRMT61A siRNA (Human)
CRJ4462-02 30 nmol

TRMT61A siRNA (Human)

Ask
View Details