Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymic stromal lymphopoietin (TSLP)

Product Specifications

Product Name Alternative

Thymic stromal lymphopoietin; Thymic stromal lymphopoietin protein TSLP; Tslp; TSLP protein; TSLP_HUMAN

Abbreviation

Recombinant Human TSLP protein

Gene Name

TSLP

UniProt

Q969D9

Expression Region

29-159aa

Organism

Homo sapiens (Human)

Target Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Isoform 1

Molecular Weight

30.9 kDa

References & Citations

"Human thymic stromal lymphopoietin preferentially stimulates myeloid cells."Reche P.A., Soumelis V., Gorman D.M., Clifford T., Liu M.-R., Travis M., Zurawski S.M., Johnston J., Liu Y.-J., Spits H., de Waal Malefyt R., Kastelein R.A., Bazan J.F.J. Immunol. 167:336-343 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROS1 Recombinant Rabbit monoclonal Antibody
HA750637 100 µL

ROS1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: Mab11]
AM26711AC-N 100 Tests

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: Mab11]

Sign In for Pricing
View Details
Recombinant Rat IL1R1/CD121a Protein (His Tag)
PKSR030394 100 µg

Recombinant Rat IL1R1/CD121a Protein (His Tag)

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF568 conjugate, 0.1mg/mL
BNC682501-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2501), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLR4 (NM_138554) Human Recombinant Protein
TP322820M 100 µg

TLR4 (NM_138554) Human Recombinant Protein

Sign In for Pricing
View Details
WWP1 Antibody
OC-018-01 50 μL

WWP1 Antibody

Sign In for Pricing
View Details