Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit C-X-C motif chemokine (CXCL9)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rabbit CXCL9 protein

Gene Name

CXCL9

UniProt

U3KNX2

Expression Region

23-124aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.5 kDa

References & Citations

"Genome Sequence of Oryctolagus cuniculus (European rabbit) ."The Genome Sequencing PlatformDi Palma F., Heiman D., Young S., Gnerre S., Johnson J., Lander E.S., Lindblad-Toh K.Submitted (AUG-2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptotagmin 11 (Synaptotagmin-11, Synaptotagmin XI, SytXI, SYT11, KIAA0080) (MaxLight 405) discontinued
134132-ML405 100 µL

Synaptotagmin 11 (Synaptotagmin-11, Synaptotagmin XI, SytXI, SYT11, KIAA0080) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-CD125 Antibody
CPA6205-01 30 µL

Anti-CD125 Antibody

Sign In for Pricing
View Details
Anti-CD125 Antibody
CPA6205-02 50 μL

Anti-CD125 Antibody

Sign In for Pricing
View Details
Anti-CD125 Antibody
CPA6205-03 100 µL

Anti-CD125 Antibody

Sign In for Pricing
View Details
Anti-CD125 Antibody
CPA6205-04 200 µL

Anti-CD125 Antibody

Sign In for Pricing
View Details
MIR5099 Mouse qPCR Primer Pair (MI0018007)
MP300713 200 Reactions

MIR5099 Mouse qPCR Primer Pair (MI0018007)

Sign In for Pricing
View Details