Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-defensin 4 (Defb4)

Product Specifications

Product Name Alternative

Defensin, beta 4

Abbreviation

Recombinant Mouse Defb4 protein

Gene Name

Defb4

UniProt

P82019

Expression Region

23-63aa

Organism

Mus musculus (Mouse)

Target Sequence

QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Has bactericidal activity

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells

Molecular Weight

20.6 kDa

References & Citations

"A novel murine beta-defensin expressed in tongue, esophagus, and trachea."Jia H.P., Wowk S.A., Schutte B.C., Lee S.K., Vivado A., Tack B.F., Bevins C.L., McCray P.B. Jr.J. Biol. Chem. 275:33314-33320 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBFOX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F9]
TA803488BM 100 µL

RBFOX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F9]

Sign In for Pricing
View Details
RAMP2 Human Gene Knockout Kit (CRISPR)
KN206531LP 1 Kit

RAMP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adamdec1 Mouse Gene Knockout Kit (CRISPR)
KN500847 1 Kit

Adamdec1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant IKZF3 Antibody
RC-5760-01 50 μL

Recombinant IKZF3 Antibody

Sign In for Pricing
View Details
Recombinant IKZF3 Antibody
RC-5760-02 100 µL

Recombinant IKZF3 Antibody

Sign In for Pricing
View Details
Recombinant IKZF3 Antibody
RC-5760-03 1 mL

Recombinant IKZF3 Antibody

Sign In for Pricing
View Details