Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacteroides fragilis Fragilysin (btfP)

Product Specifications

Product Name Alternative

Enterotoxin

Abbreviation

Recombinant Bacteroides fragilis btfP protein

Gene Name

BtfP

UniProt

P54355

Expression Region

26-405aa

Organism

Bacteroides fragilis

Target Sequence

ACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPKAEGYDDQIYFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGHILGAEHTDNSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen.

Molecular Weight

58.6 kDa

References & Citations

"Cloning and characterization of the gene for the metalloprotease enterotoxin of Bacteroides fragilis."Kling J.J., Wright R.L., Moncrief J.S., Wilkins T.D.FEMS Microbiol. Lett. 146:279-284 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Sample Volume Mouse Fibroblast Growth Factor 19 (FGF19) ELISA Kit
TRV-0002480 96 Well Plate

Low Sample Volume Mouse Fibroblast Growth Factor 19 (FGF19) ELISA Kit

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
MBS2058131-01 0.1 mL

PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
MBS2058131-02 0.2 mL

PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
MBS2058131-03 0.5 mL

PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
MBS2058131-04 1 mL

PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
MBS2058131-05 5 mL

PE-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details