Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chymase (CMA1)

Product Specifications

Product Name Alternative

Alpha-chymase Mast cell protease I

Abbreviation

Recombinant Human CMA1 protein

Gene Name

CMA1

UniProt

P23946

Expression Region

22-247aa

Organism

Homo sapiens (Human)

Target Sequence

IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.

Molecular Weight

29 kDa

References & Citations

"Cloning of the gene and cDNA for human heart chymase."Urata H., Kinoshita A., Perez D.M., Misono K.S., Bumpus F.M., Graham R.M., Husain A.J. Biol. Chem. 266:17173-17179 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat IL-13, 113a.a.
REILP-1302 10 µg

Recombinant Rat IL-13, 113a.a.

Sign In for Pricing
View Details
ART5 Polyclonal Antibody, FITC Conjugated
bs-9105R-FITC 100 µL

ART5 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)
MBS2035740-01 0.1 mL

PE-Linked Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)
MBS2035740-02 0.2 mL

PE-Linked Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)
MBS2035740-03 0.5 mL

PE-Linked Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)
MBS2035740-04 1 mL

PE-Linked Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)

Sign In for Pricing
View Details