Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Epididymal secretory protein E1 (NPC2)

Product Specifications

Product Name Alternative

Niemann Pick type C2 protein homolog cE1

Abbreviation

Recombinant Dog NPC2 protein

Gene Name

NPC2

UniProt

Q28895

Expression Region

22-149aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting membrane of late endosomes/ lysosomes to the ER and plasma membrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting membrane of late endosomes/ lysosomes to the ER and plasma membrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport (By similarity) .

Molecular Weight

30 kDa

References & Citations

"Gene expression in the dog epididymis: a model for human epididymal function."Ellerbrock K., Pera I., Hartung S., Ivell R.Int. J. Androl. 17:314-323 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL6/GCP-2 Recombinant Rabbit monoclonal Antibody
HA723316B 100 µL

Human CXCL6/GCP-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Propan-2-yl 2-Sulfanylacetate
TRC-B524470-250MG 250 mg

Propan-2-yl 2-Sulfanylacetate

Sign In for Pricing
View Details
Beta Catenin Recombinant Mouse Monoclonal Antibody [A6-F8-R]
HA601179 100 µL

Beta Catenin Recombinant Mouse Monoclonal Antibody [A6-F8-R]

Sign In for Pricing
View Details
Mouse RANTES Antibody Pair Set
E-KAB-0289 50 µL & 100 µg

Mouse RANTES Antibody Pair Set

Sign In for Pricing
View Details
N1-Nornicergoline
TRC-N756600-5MG 5 mg

N1-Nornicergoline

Sign In for Pricing
View Details
GMPR2 (NM_001002002) Human Recombinant Protein
TP323106M 100 µg

GMPR2 (NM_001002002) Human Recombinant Protein

Sign In for Pricing
View Details