Recombinant Mouse Thyroid hormone-inducible hepatic protein (Thrsp)
Product Specifications
Product Name Alternative
Spot 14 protein Short name: S14 Short name: SPOT14
Abbreviation
Recombinant Mouse Thrsp protein
Gene Name
Thrsp
UniProt
Q62264
Expression Region
1-150aa
Organism
Mus musculus (Mouse)
Target Sequence
MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL
Tag
N-terminal 6xHis-SUMO-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Signal Transduction
Relevance
Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB (By similarity) .
Molecular Weight
33.1 kDa
References & Citations
"Cloning and initial characterization of human and mouse Spot 14 genes."Grillasca J.-P., Gastaldi M., Khiri H., Dace A., Peyrol N., Reynier P., Torresani J., Planells R.FEBS Lett. 401:38-42 (1997)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![DR5 (TNFRSF10B) Mouse Monoclonal Antibody [Clone ID: OTI1B9]](https://cdn.genprice.uk/products/937/68dd18b9061270361e908044/imageurl/cf807279.webp)
CF807279 100 µg
DR5 (TNFRSF10B) Mouse Monoclonal Antibody [Clone ID: OTI1B9]
Sign In for Pricing
View Details 
TRC-D449740-25G 25 g
1,4-Dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester
Sign In for Pricing
View Details 
BNC682844-100 1x 100 µL
Spastin (Sp 3G11-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Smad1 Recombinant Rabbit Monoclonal Antibody [SD2090]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82800/imageurl/et1612-39.webp)
ET1612-39 100 µL
Smad1 Recombinant Rabbit Monoclonal Antibody [SD2090]
Sign In for Pricing
View Details