Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12)

Product Specifications

Product Name Alternative

Endoplasmic reticulum resident protein 19 Short name: ER protein 19 Short name: ERp19 Thioredoxin-like protein p19

Abbreviation

Recombinant Mouse Txndc12 protein

Gene Name

Txndc12

UniProt

Q9CQU0

Expression Region

25-170aa

Organism

Mus musculus (Mouse)

Target Sequence

RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Possesses significant protein thiol-disulfide oxidase activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Possesses significant protein thiol-disulfide oxidase activity.

Molecular Weight

18.5 kDa

References & Citations

"ERp19 and ERp46, new members of the thioredoxin family of endoplasmic reticulum proteins."Knoblach B., Keller B.O., Groenendyk J., Aldred S., Zheng J., Lemire B.D., Li L., Michalak M.Mol. Cell. Proteomics 2:1104-1119 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF Receptor II/TNFRSF1B Rabbit Polyclonal Antibody (Fluoro488)
orb3114037 100 µg

TNF Receptor II/TNFRSF1B Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Amino terminal enhancer of split (AES) (NM_001130) Human Over-expression Lysate
LY420115 100 µg

Amino terminal enhancer of split (AES) (NM_001130) Human Over-expression Lysate

Sign In for Pricing
View Details
Opiates test in urine
C8102 40 Tests

Opiates test in urine

Sign In for Pricing
View Details
AK5 (Adenylate Kinase Isoenzyme 5, AK 5, ATP-AMP Transphosphorylase 5)
304929 100 µL

AK5 (Adenylate Kinase Isoenzyme 5, AK 5, ATP-AMP Transphosphorylase 5)

Sign In for Pricing
View Details
3- (Morpholin-4-ylsulphonyl) benzeneboronic acid
OR5713 250 mg

3- (Morpholin-4-ylsulphonyl) benzeneboronic acid

Sign In for Pricing
View Details
PSGL-1/CD162 Recombinant Antibody, Cy5 Conjugated
bsm-61840R-Cy5-TR 20 µL

PSGL-1/CD162 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details